TLR8 antibody
200 µg
70R-14932
635 EUR
Primary Antibody
Polyclonal Antibodies, Purified
Signal Transduction
TLR8 antibodies were raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 .
Goat
TLR8 antibody was purified by affinity chromatography
1 mg/ml
Provided in 10 mM KHPO4, 140 mM NaCl with 0.1 % NaN3
Aliquot and freeze at -20 deg C. Avoid freeze-thaw cycles
Blue Ice
IHC; WB
IHC: 1:125, WB: 1:500
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
anticorps